PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT1G07640.2
Common NameDOF1.1, F24B9.30, OBP2, URP3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family Dof
Protein Properties Length: 331aa    MW: 35589.3 Da    PI: 9.775
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT1G07640.2genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof121.43.1e-3877132661
       zf-Dof   6 lkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                  lkcprCds+ntkfCyynny+l+qPr+fCk+CrryWt+GGalrnvPvGgg+r+n+k+
  AT1G07640.2  77 LKCPRCDSSNTKFCYYNNYNLTQPRHFCKGCRRYWTQGGALRNVPVGGGCRRNNKK 132
                  79**************************************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-3659128IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.62777131IPR003851Zinc finger, Dof-type
PfamPF027013.4E-3277131IPR003851Zinc finger, Dof-type
PROSITE patternPS01361079115IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003002Biological Processregionalization
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009611Biological Processresponse to wounding
GO:0009625Biological Processresponse to insect
GO:0009753Biological Processresponse to jasmonic acid
GO:0010439Biological Processregulation of glucosinolate biosynthetic process
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
GO:0046872Molecular Functionmetal ion binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0003015anatomyprimary root differentiation zone
PO:0005417anatomyphloem
PO:0006203anatomypericycle
PO:0008019anatomyleaf lamina base
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0020030anatomycotyledon
PO:0020038anatomypetiole
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0025257anatomyprimary root elongation zone
PO:0025281anatomypollen
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 331 aa     Download sequence    Send to blast
MPTNSNHQHH LQHQLNENGS IISGHGLVLS HQLPPLQANP NPNHHHVATS AGLPSRMGGS  60
MAERARQANI PPLAGPLKCP RCDSSNTKFC YYNNYNLTQP RHFCKGCRRY WTQGGALRNV  120
PVGGGCRRNN KKGKNGNLKS SSSSSKQSSS VNAQSPSSGQ LRTNHQFPFS PTLYNLTQLG  180
GIGLNLAATN GNNQAHQIGS SLMMSDLGFL HGRNTSTPMT GNIHENNNNN NNENNLMASV  240
GSLSPFALFD PTTGLYAFQN DGNIGNNVGI SGSSTSMVDS RVYQTPPVKM EEQPNLANLS  300
RPVSGLTSPG NQTNQYFWPG SDFSGPSNDL L
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.148460.0flower| root
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible261409_at0.0
Expression AtlasAT1G07640-
AtGenExpressAT1G07640-
ATTED-IIAT1G07640-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Predominantly expressed in leaves and roots. {ECO:0000269|PubMed:10758484}.
Functional Description ? help Back to Top
Source Description
TAIRA member of the DOF transcription factors. Prominently expressed in the phloem of leaves and other organs. Expression is induced by wounding, MeJA and insect feeding. Upregulates glucosinolate biosynthesis.
UniProtTranscription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence. Enhances the DNA binding of OBF transcription factors to OCS elements.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT1G07640.2
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By auxin and salicylic acid (SA). {ECO:0000269|PubMed:10758484}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Regulation -- ATRM (Manually Curated Target Genes) ? help Back to Top
Source Target Gene (A: Activate/R: Repress)
ATRM AT2G22330(A), AT3G56970(A), AT3G56980(A), AT4G31500(A), AT4G39950(A), AT5G23010(A)
Regulation -- Hormone ? help Back to Top
Source Hormone
AHDjasmonic acid
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT1G07640
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0627150.0AY062715.1 Arabidopsis thaliana Strong similarity to zinc finger protein OBP2 (At1g07640; F24B9.30) mRNA, complete cds.
GenBankCP0026840.0CP002684.1 Arabidopsis thaliana chromosome 1 sequence.
GenBankF24B90.0AC007583.2 Arabidopsis thaliana chromosome 1 BAC F24B9 sequence, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_563792.30.0DOF transcription factor OBP2
SwissprotQ8L9V60.0DOF11_ARATH; Dof zinc finger protein DOF1.1
TrEMBLQ2V4Q10.0Q2V4Q1_ARATH; Dof zinc finger protein DOF1.1
STRINGAT1G07640.30.0(Arabidopsis thaliana)
Publications ? help Back to Top
  1. Kang HG,Singh KB
    Characterization of salicylic acid-responsive, arabidopsis Dof domain proteins: overexpression of OBP3 leads to growth defects.
    Plant J., 2000. 21(4): p. 329-39
    [PMID:10758484]
  2. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  3. Yanagisawa S
    The Dof family of plant transcription factors.
    Trends Plant Sci., 2002. 7(12): p. 555-60
    [PMID:12475498]
  4. Park DH, et al.
    The Arabidopsis COG1 gene encodes a Dof domain transcription factor and negatively regulates phytochrome signaling.
    Plant J., 2003. 34(2): p. 161-71
    [PMID:12694592]
  5. Lijavetzky D,Carbonero P,Vicente-Carbajosa J
    Genome-wide comparative phylogenetic analysis of the rice and Arabidopsis Dof gene families.
    BMC Evol. Biol., 2003. 3: p. 17
    [PMID:12877745]
  6. Yamada K, et al.
    Empirical analysis of transcriptional activity in the Arabidopsis genome.
    Science, 2003. 302(5646): p. 842-6
    [PMID:14593172]
  7. Zhao C,Craig JC,Petzold HE,Dickerman AW,Beers EP
    The xylem and phloem transcriptomes from secondary tissues of the Arabidopsis root-hypocotyl.
    Plant Physiol., 2005. 138(2): p. 803-18
    [PMID:15923329]
  8. Lee JY, et al.
    Transcriptional and posttranscriptional regulation of transcription factor expression in Arabidopsis roots.
    Proc. Natl. Acad. Sci. U.S.A., 2006. 103(15): p. 6055-60
    [PMID:16581911]
  9. Yoine M,Ohto MA,Onai K,Mita S,Nakamura K
    The lba1 mutation of UPF1 RNA helicase involved in nonsense-mediated mRNA decay causes pleiotropic phenotypic changes and altered sugar signalling in Arabidopsis.
    Plant J., 2006. 47(1): p. 49-62
    [PMID:16740149]
  10. Skirycz A, et al.
    DOF transcription factor AtDof1.1 (OBP2) is part of a regulatory network controlling glucosinolate biosynthesis in Arabidopsis.
    Plant J., 2006. 47(1): p. 10-24
    [PMID:16740150]
  11. Nakano T, et al.
    Identification of genes of the plant-specific transcription-factor families cooperatively regulated by ethylene and jasmonate in Arabidopsis thaliana.
    J. Plant Res., 2006. 119(4): p. 407-13
    [PMID:16820983]
  12. Yang X,Tuskan GA,Cheng MZ
    Divergence of the Dof gene families in poplar, Arabidopsis, and rice suggests multiple modes of gene evolution after duplication.
    Plant Physiol., 2006. 142(3): p. 820-30
    [PMID:16980566]
  13. Brady SM, et al.
    A stele-enriched gene regulatory network in the Arabidopsis root.
    Mol. Syst. Biol., 2011. 7: p. 459
    [PMID:21245844]
  14. Gaudinier A, et al.
    Enhanced Y1H assays for Arabidopsis.
    Nat. Methods, 2011. 8(12): p. 1053-5
    [PMID:22037706]
  15. Waki T, et al.
    A GAL4-based targeted activation tagging system in Arabidopsis thaliana.
    Plant J., 2013. 73(3): p. 357-67
    [PMID:23057675]
  16. Jin J, et al.
    An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors.
    Mol. Biol. Evol., 2015. 32(7): p. 1767-73
    [PMID:25750178]